
Thank you

Today (December 31) is the last day for the Quicklisp appreciation fundraiser. It has met and exceeded the matching fund goal by a wide margin. I am so thankful of all the support for this fundraiser, but also for the many kind words of appreciation, and for the "Quicklisp supporter club" donors, over the years. The positive feedback has made the work very satisfying.

Thank you, and best wishes for a happy 2017!


December 2016 Quicklisp dist update now available

Note: The Quicklisp fundraiser is up and running. If you appreciate Quicklisp, please contribute if you can.

New projects:
  • cl-digraph — Simple directed graphs for Common Lisp. — MIT/X11
  • cl-directed-graph — Directed graph data structure — MIT
  • format-string-builder — A DSL wrapping cl:format's syntax with something more lispy. — MIT
  • hunchentools — Hunchentoot utility library — MIT
  • l-system — L-system or Lindenmayer system on lists — GPLv3+
  • parser.common-rules — Provides common parsing rules that are useful in many grammars. — MIT
  • parser.ini — Provides parsing of Ini expressions. — LLGPLv3
  • postmodernity — Utility library for the Common Lisp Postmodern library — MIT
  • stl — Load triangle data from binary stereolithography (STL) files. — ISC
  • whofields — HTML field rendering and input validation utilities written in Common Lisp — MIT
Updated projects3bmdalexaalexandriaarchitecture.builder-protocolarchitecture.hooksarchitecture.service-providerasdf-dependency-grovelbeastcarriercaveman2-widgetscellsceplcepl.drm-gbmcepl.sdl2cepl.skittercircular-streamscl+sslcl-anacl-autowrapcl-bootstrapcl-cacl-change-casecl-dbicl-dotcl-drmcl-gistscl-growlcl-jpegcl-kanrencl-l10ncl-libyamlcl-mediawikicl-mpg123cl-openglcl-out123cl-pangocl-portaudiocl-pslibcl-quickcheckcl-sdl2clackclavierclfswmclinchcltclcoleslawcollectorscroatoandbusdendritedjuladocumentation-utilsdynaeazy-gnuplotesrapfare-scriptsformletsgbbopengendlgenevagsllgtk-cffihttp-bodyhu.dwim.computed-classhu.dwim.defhu.dwim.presentationhu.dwim.serializerhu.dwim.syntax-sugarhyperluminal-meminquisitorjskenzolacklasslegitmcclimmetabang-bindmeteringmglmitomodularizemodularize-interfacesneo4clnibblesningleoclclopticlpgloaderpng-readpostmodernprotobufpsychiqqlotqt-libsqtoolsquickutilquriratifyretrospectiffrutilsserapeumskitterspinneretstaplestumpwmsxqltriviatrivial-documentationtrivial-featurestrivial-nntptrivial-rfc-1123trivial-yencubiquitousufoutilities.print-treeutility-argumentsutils-ktvarjowebsocket-driverwhat3wordswookieworkout-timerxml.location.

Removed projects: cl-xspf, date-calc, elephant, html-entities, lambda-gtk, perfpiece, quicksearch, usocket-udp.

To get this update, use (ql:update-dist "quicklisp"). Enjoy!


October 2016 Quicklisp dist update now available

New projects:
  • architecture.builder-protocol — Protocol and framework for building parse results and other object graphs. — LLGPLv3
  • cepl.drm-gbm — DRM/GBM host for cepl — BSD 3-Clause
  • cl-association-rules — An implementation of the apriori algorithm to mine association rules in Common Lisp. — MIT
  • cl-change-case — Convert strings between camelCase, param-case, PascalCase and more — LLGPL
  • cl-drm — Common Lisp bindings for libdrm — BSD 3-Clause
  • cl-egl — Common Lisp wrapper for libEGL — BSD 3-Clause
  • cl-gbm — Common Lisp wrapper for libgbm — BSD 3-Clause
  • cl-wayland — libwayland bindings for Common Lisp — BSD 3-Clause
  • cl-xkb — Common Lisp wrapper for libxkb — BSD 3-Clause
  • cltcl — Embed Tcl/Tk scripts in Common Lisp — MIT
  • diff-match-patch — A Common Lisp port of Neil Fraser's library of the same name — Apache 2.0
  • exit-hooks — Call registered function when Common Lisp Exits. — BSD
  • grovel-locally — Grovel using cffi and cache the result locally to the system — BSD 2 Clause
  • portable-threads — Portable Threads — Apache License 2.0
Updated projects: 3d-matrices3d-vectorsalexaalexandriaassoc-utilscavemancaveman2-widgetscfficircular-streamscl-anacl-autowrapcl-bootstrapcl-cudacl-hash-utilcl-html-parsecl-influxdbcl-kanrencl-l10ncl-libfarmhashcl-libhoedowncl-openglcl-protobufscl-pslibcl-quickcheckcl-rabbitcl-redditcl-scancl-sdl2cl-stringsclim-pkg-docclim-widgetscloser-mopclxcoleslawcolleencroatoandbusdexadoresrapesrap-liquidfiascofngendlglsl-specgraphhttp-bodyhu.dwim.graphvizhumblerhunchensocketjonathanlacklakelasslisp-criticmaxpcmcclimmitomodularize-hooksmodularize-interfacesnorthparse-floatpostmodernrecursive-restartrtg-mathrutilssnmpsnoozestumpwmtemporal-functionstrivial-string-templateubiquitousuiopusocketutilities.binary-dumpvarjoweblocksxml-emitterzs3.

Removed projects: asn.1, cl-bacteria, cl-binary-file, cl-btree, cl-ntriples, cl-op, cl-swap-file, cl-wal, cl-web-crawler, doplus, esrap-peg.

There are more removed projects than usual this month. asn.1 was removed by request of the author. esrap-peg no longer builds - it may be back soon. All the others are victims of Google Code and SourceForge. Their code can no longer be easily checked out or updated, they don't affect other projects, and nobody has come forward to move them somewhere else and maintain them. If you miss any of those projects, feel free to take it over and let me know.

To get this month's update, use (ql:update-dist "quicklisp"). Enjoy!


Projects on the bubble

This month there are a number of projects that may be dropped from Quicklisp. They are hosted by Google Code and SourceForge, and the projects no longer check out properly. They are:
Each of these projects was downloaded between 4 and 6 times in the month of September. (No project in the entire dist was downloaded fewer than 4 times.)

I'm going to do some build-testing and see how widely this will impact other projects. If the damage is minimal, they will simply be dropped.

If you maintain (or want to maintain) one of these projects and want to see it remain in Quicklisp, please update its hosting and then get in touch.


September 2016 Quicklisp dist update now available

New projects:
  • 3d-matrices — A utility library implementing 2x2, 3x3, 4x4, and NxN matrix functionality. — Artistic
  • a-cl-logger — A logger that sends to multiple destinations in multiple formats. Based on arnesi logger — BSD
  • alexa — A lexical analyzer generator — BSD 3-clause (See LICENSE.txt)
  • beast — Basic Entity/Aspect/System Toolkit — MIT/X11
  • cl-ascii-art — Ascii Art generating routines. — GPLv3
  • cl-bootstrap — Twitter Bootstrap widget library for Common Lisp — MIT
  • cl-cuda — Cl-cuda is a library to use NVIDIA CUDA in Common Lisp programs. — LLGPL
  • cl-kanren — A minikanren implementation — BSD
  • easy-audio — A pack of audio decoders for FLAC, WavPack and other formats — 2-clause BSD
  • fxml — Fork of CXML. — LLGPL
  • infix-math — An extensible infix syntax for math in Common Lisp. — MIT
  • mgl-mat — MAT is library for working with multi-dimensional arrays which supports efficient interfacing to foreign and CUDA code. BLAS and CUBLAS bindings are available. — MIT
  • parachute — An extensible and cross-compatible testing framework. — Artistic
  • scalpl — market maker + APIs to several Bitcoin exchanges — public domain
  • trivial-mmap — A library providing an easy-to-use API for working with memory-mapped files. — Public Domain
  • utility-arguments — Utility to handle command-line arguments. — ICS
Updated projects3d-vectorsacclimationarchitecture.service-providerarray-utilsarrow-macrosbknr-datastorecarriercaveman2-widgetscellschanlchirpcl-anacl-bloomcl-coroutinecl-freeimagecl-gamepadcl-glfw3cl-inotifycl-interpolcl-ixfcl-lexcl-monitorscl-mpg123cl-mtgnetcl-neovimcl-oclapicl-openglcl-out123cl-packcl-rabbitclackclfswmclipclobbercloser-mopclssclxcodexcoleslawcolleencroatoancrypto-shortcutsdeedsdeferreddexadordissectdocumentation-utilsesrapfare-scriptsfile-typesflareforform-fiddlegbbopengendlgenevahu.dwim.bluezhu.dwim.sdlhumblerinferior-shellinlined-generic-functionkenzolacklakelambda-fiddlelasslegitlisp-invocationlquerymaxpcmcclimmitomito-authmodularizemodularize-hooksmodularize-interfacesmore-conditionsmpcpathname-utilspgloaderpipingplumpplump-bundleplump-sexppostmodernptesterpurlqlotqt-libsqtoolsqtools-uiqueen.lispquriracerrandom-stateratifyredirect-streamrtg-mathrutilsserapeumsha3simple-inferiorssimple-taskssnoozesoftdrinksouthspinneretstaplestatic-vectorsstumpwmswap-bytestriviatrivial-argumentstrivial-benchmarktrivial-indenttrivial-main-threadtrivial-mimestrivial-rfc-1123trivial-thumbnailubiquitousutilities.binary-dumputilities.print-itemsverboseweblocksweblocks-prototype-jswith-cached-reader-conditionalswoozenekindarl.

Removed projects: agm, ax.tga, cl-ecs, cl-marklogic, com.informatimago.

To get this update, use (ql:update-dist "quicklisp").



August 2016 Quicklisp dist update now available

New projects:
  • assoc-utils — Utilities for manipulating association lists — Public Domain
  • caveman2-widgets-bootstrap — An extension to caveman2-widgets which enables the simple usage of Twitter Bootstrap. — LLGPL
  • cells — A Common Lisp implementation of the dataflow programming paradigm — LLGPL
  • cl-mpg123 — Bindings to libmpg123, providing cross-platform, fast MPG1/2/3 decoding. — Artistic
  • cl-neovim — Common Lisp client for Neovim — MIT
  • cl-out123 — Bindings to libout123, providing cross-platform audio output. — Artistic
  • cl-soil — A thin binding over libSOIL.so which allows easy loading of images — BSD 2 Clause
  • cl-sxml — SXML parsing for Common Lisp — GNU General Public License
  • clump — Library for operations on different kinds of trees — FreeBSD, see file LICENSE.text
  • dirt — A front-end for cl-soil which loads images straight to cepl:c-arrays and cepl:textures — BSD 2 Clause
  • ext-blog — A BLOG engine which supports custom theme — BSD
  • for — An extensible iteration macro library. — Artistic
  • git-file-history — Retrieve a file's commit history in Git. — MIT
  • illogical-pathnames — Mostly filesystem-position-independent pathnames. — BSD 3-clause (See illogical-pathnames.lisp)
  • maxpc — Max's Parser Combinators: a simple and pragmatic library for writing parsers and lexers based on combinatory parsing. — GNU Affero General Public License
  • parse-front-matter — Parse front matter. — MIT
  • path-string — A path utility library — MIT
  • pseudonyms — Relative package nicknames through macros — FreeBSD (BSD 2-clause)
  • quantile-estimator.cl — Common Lisp implementation of Graham Cormode and S. Muthukrishnan's Effective Computation of Biased Quantiles over Data Streams in ICDE'05 — MIT
  • queen.lisp — Chess utilities for Common Lisp — MIT
  • read-number — Definitions for reading numbers from an input stream. — Modified BSD License
  • simple-gui — A declarative GUI definition tool for Common Lisp — BSD
  • slack-client — Slack Real Time Messaging API Client — Apache-2.0
  • trivial-rfc-1123 — minimal parsing of rfc-1123 date-time strings — MIT
  • with-cached-reader-conditionals — Read whilst collection reader conditionals — BSD 2 Clause
Updated projects3bmd3d-vectorsagmalexandriabinfixburgled-batteriescavemancaveman2-widgetsceplcepl.cameracepl.devilcepl.sdl2cepl.skitterceramicchirpcity-hashcl-anacl-asynccl-azurecl-conspackcl-ecscl-fadcl-gamepadcl-gracecl-influxdbcl-jpegcl-libuvcl-messagepackcl-messagepack-rpccl-mpicl-mtgnetcl-oclapicl-openglcl-openstack-clientcl-packcl-quickcheckcl-rediscl-rethinkdbcl-scancl-sdl2cl-smtpcl-stringscl-tokyo-cabinetcl-unificationcl-yaclyamlcl-yamlclackclassimpclmlclos-fixturescloser-mopclxclx-truetypecoleslawcollectorscorona,croatoandbusdendritedexadordissectdjulaeazy-gnuplotesrapexscribeexternal-programfare-memoizationfare-scriptsfiveamflarefngendlgenevaglkitglsl-specgslliteratejson-mopkenzo,lacklambda-fiddlelisp-namespacelispbuilderlparallelmcclimmel-baseneo4cloclclopticlosicatprometheus.clproveqlotqt-libsqtoolsqtools-uiquickapprandom-staterclremote-jsrestasrtg-mathserapeumsip-hashskitterspinneretsquirlstumpwmtreedbtriviatrivial-documentationtrivial-nntptrivial-open-browsertrivial-wstrivialib.type-unifyubiquitousugly-tiny-infix-macro,utilities.print-itemsutilities.print-treevarjovgplotvomweblocksweblocks-utilswoowu-sugar.

Removed projects: scalpl.


June 2016 Quicklisp dist update now available

New projects:
  • cl-libfarmhash — Common Lisp Binding for Google's Farmhash. — MIT
  • cl-libhoedown — Common Lisp Binding for Hoedown. — MIT
  • cl-sat — Common Lisp API to Boolean SAT Solvers — LLGPL
  • cl-sat.glucose — CL-SAT instance to Glucose state-of-the-art SAT solver. This downloads the later 2014 version (2nd in the 2014 SAT competition). — LLGPL
  • cl-sat.minisat — Common Lisp API to minisat — LLGPL
  • floating-point-contractions — Numerically stable contractions of floating-point operations. — MIT
  • metering — Portable Code Profiling Tool — Public Domain
  • neo4cl — Basic library for interacting with Neo4J — MIT license
  • network-addresses — A network addresses manipulation library. — MIT
  • ugly-tiny-infix-macro — A tiny and simple macro to allow writing binary operations in infix notation — Apache License, Version 2.0
Updated projects3d-vectorsacclimationarchitecture.service-providercaveman2-widgetscity-hashcl-anacl-asynccl-autowrapcl-conspackcl-hash-utilcl-htmlpragcl-i18ncl-messagepack-rpccl-monitorscl-mysqlcl-oclapicl-odecl-rediscl-scancl-sdl2clackclack-static-asset-middlewareclinchcloser-mopcopy-directorycss-selectorsdeedsdefpackage-plusdjulaeazy-projectepigraphesrap-liquidexscribefast-iofixedglkitglsl-specgsllhash-setinlined-generic-functionlegitlocal-timelquerymap-setmcclimminheapmontezumaoclclprometheus.clqt-libsrestasscribblesdl2kitserapeumsmart-bufferspinneretsquirltriviatrivial-nntptrivial-openstacktrivial-wstrivial-yencubiquitousutilities.binary-dumputilities.print-treeverbosevomweblocksweblocks-utilswoowookiewu-sugarzs3.

Removed projectsbackportsext-blogstp-query, and stringprep have all been abandoned by their author and deleted from github. cells no longer builds on SBCL, and ext-blog no longer builds at all.

To get this update, use (ql:update-dist "quicklisp").

The big Quicklisp fundraiser is still in limbo. Until it happens, if you want to contribute a little every month, see the (unfortunately PayPal-only) donations page.